Human Activin-B
Slide this table
Cat-Nr. | 100-330S |
Size | 1 µg |
Price | 75 € |
Source | Insect cells |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE & HPLC analyses |
Length [aa] | 115 |
Molecular Weight | 25.6 kDa |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5 x 105 units/mg. |
Species Reactivity | Human |
Synonyms | INHBB, Inhibin beta-2, Activin beta-B |
Description | Activin B is a TGF-β family member that exhibits a wide range of biological activities including regulation of embryogenesis, osteogenesis, hematopoiesis, reproductive physiology and hormone secretion from the hypothalamic, pituitary and gonadal glands. Activin B, like certain other members of the TGF-β family, signals through the ActRII receptor (Activin Receptor type II). Human Activin B is a 25.6 kDa disulfide-linked homodimer consisting of two βB chains, each containing 115 amino acid residues. |
Protein Sequence | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
Uniprot ID | P06529 |
Protein RefSeq | NP_002184.2 |
mRNA RefSeq | NM_002193.2 |
All prices plus VAT + possible delivery charges