human IL-1 receptor antagonist, soluble protein Human 5 µg

In stock

Cat-Nr.
S01-061S
Size
5 µg
  €112.00

Description / human IL-1 receptor antagonist, soluble protein

IL-6 mediates its biological effects through the type I IL-6 receptor system that consists of two chains, IL-6Rα and gp130. The IL-6Rα chain is the binding component specific to IL-6; while the gp130 only transmits signals of IL-6 when bound to IL-6Rα. The gp130 also can transmit signals from LIF, OSM, CNTF, IL-11 and CT-1 in conjunction with other receptor subunits. The low-affinity binding site for IL-6 is composed of IL-6Rα alone. IL-6Rα is expressed in a wide range of cells including T cells, fibroblasts and macrophages. Soluble IL-6Rα which consists of only the extracellular domain of the IL-6Rα chain, acts as an agonist of IL-6 activity at low concentrations. Recombinant human sIL-6Rα is a 37.6 kDa protein consisting of the extracellular domain of the IL-6Rα chain (339 amino acid residues).

More Information

Size 5 µg
Source HEK 293 cells
Biological Activity The ED50 was determined by its ability to intensify the IL-6 induced growth inhibition of murine M1 cells is ≤ 5.0 ng/ml, in the presence of 20 ng/ml of rhIL-6.
Purity Confirmation > 98% by SDS-PAGE & HPLC analysis
Length [aa] 339
Molecular Weight 37.2 kDa
Species Reactivity Mouse, Rat, Human
Formulation lyophilized
Protein Sequence LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ
Synonyms soluble IL-6 receptor alpha, B cell stimulatory factor-2, CD126
Uniprot ID P08887
Protein RefSeq NP_000556.1.
mRNA RefSeq NM_000565.3

All prices plus VAT + possible delivery charges