chicken Growth Hormone mutant (G119R) protein Chicken 10 µg
Description / chicken Growth Hormone mutant (G119R) protein
Chicken recombinant growth hormone (chGH) mutein G119R produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22.3 kDa. For reference see Eliasiewicz et al. (2006) Ann N Y Acad Sci. 1091:501-508.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Chicken recombinant growth hormone G119R mutant did not bind to ovine growth hormone extracellular domain (ECD) and was devoid of any biological activity in FDC-P1 3B9 cells. However, in binding experiments that were carried out using chicken liver membra |
| N Terminal Sequence | ATFPA |
| Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 191 |
| Molecular Weight | 22.3 kDa |
| Formulation | lyophilized |
| Protein Sequence | ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEERIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI |
| Reconstitution | It is recommended to reconstitute the lyophilized chicken recombinant growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, prefer |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | P08998 |
| Protein RefSeq | NP_989690.1 |
| mRNA RefSeq | NM_204359.2 |