fish (denis) Growth Hormone protein Fish (denis) 50 µg

In stock

Cat-Nr.
500-020
Size
50 µg
  €304.00

Description / fish (denis) Growth Hormone protein

Recombinant Gilthead Seabream (Sparus aurata) growth hormone (gsGH) produced in E. coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of ~ 21.392 kDa. Recombinant Gilthead Seabream growth hormone was purified by chromatographic techniques, according to Ben-Atia et al., General and Comparative Endocrinology 113, 155–164 (1999).

More Information

Size 50 µg
Source E. coli
Biological Activity Binding assays of the 125I-labeled recombinant Gilthead Seabream growth hormone to dolphin fish liver microsomal fraction resulted in high specific binding characterized by a Ka of 1.93 nM and a Bmax of 540 fmol/mg microsomal fraction protein. Recombinant
N Terminal Sequence AQPITDGQRL
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE.
Length [aa] 188
Molecular Weight 21.4 kDa
Formulation lyophilized
Protein Sequence AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Reconstitution It is recommended to reconstitute the lyophilized recombinant Gilthead Seabream growth hormone in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P29971
Protein RefSeq AAB19750.2
mRNA RefSeq S54890.1

All prices plus VAT + possible delivery charges